PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10019440m
Common NameCARUB_v10019440mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 310aa    MW: 33735.7 Da    PI: 7.4117
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10019440mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.39.9e-20651147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde+l + v+++G+++W++I++ ++ gR++k+c++rw + 
  Carubv10019440m  6 KGPWSQEEDEQLRRMVEKYGPRNWSAISKSIP-GRSGKSCRLRWCNQ 51
                     79******************************.***********985 PP

2Myb_DNA-binding51.72e-1660102347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++eEde +v a  ++G++ W+tIar ++ gRt++ +k++w++ 
  Carubv10019440m  60 PFSPEEDETIVTARSKFGNK-WATIARLLN-GRTDNAVKNHWNST 102
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.985156IPR017930Myb domain
SuperFamilySSF466891.55E-31399IPR009057Homeodomain-like
SMARTSM007173.2E-18554IPR001005SANT/Myb domain
PfamPF002492.3E-19651IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-26759IPR009057Homeodomain-like
CDDcd001671.37E-17850No hitNo description
SMARTSM007174.6E-1457105IPR001005SANT/Myb domain
PROSITE profilePS5129419.40458107IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2160106IPR009057Homeodomain-like
CDDcd001674.00E-1160103No hitNo description
PfamPF002491.5E-1360102IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0010200Biological Processresponse to chitin
GO:0048527Biological Processlateral root development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MADRVKGPWS QEEDEQLRRM VEKYGPRNWS AISKSIPGRS GKSCRLRWCN QLSPEVEHRP  60
FSPEEDETIV TARSKFGNKW ATIARLLNGR TDNAVKNHWN STLKRKCGGG GVATTTMTAD  120
EEEDDQDRPK KRRSVSFDSA FAPVDTGLYM SPESPIVSDS STIPSPSSPV AQLFKPMPIC  180
GGFAVVPQPL PVEMTSSSDD PPTSLSLSLP GAENTSSSHN HNSNNNNNNT LMFPRFESQM  240
KINVEERGVG GGGGGGEGRR GEFMTVVREM VKAEVRSYMT EMQRTSGNGG GGFVVGGYRD  300
CGIITPKVE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-3951073105C-Myb DNA-Binding Domain
1msf_C3e-3951073105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00400DAPTransfer from AT3G50060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006293134.10.0hypothetical protein CARUB_v10019440mg
SwissprotQ9FDW11e-105MYB44_ARATH; Transcription factor MYB44
TrEMBLR0FT810.0R0FT81_9BRAS; Uncharacterized protein
STRINGAT3G50060.11e-157(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135981527
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.11e-128myb domain protein 77